IL6, Human
Species: | Human |
Expression System: | E.coli |
MW: | 21 kDa (reducing) |
Accession: | P05231 |
Cat No. | UA040052 |
Endotoxin: | ＜1 EU/μg |
Purity: | >95% as determined by SDS-PAGE |
INTRODUCTION
Interleukin-6 (IL-6) is a member of the pro-inflammatory cytokine family, induces the expression of a variety of proteins responsible for acute inflammation, and plays an important role in the proliferation and differentiation of cells in humans. Interleukin 6 was originally identified as a T cell derived lymphokine that induces final maturation of B cells into antibody-producing cells. Recombinant human IL-6 acts on B cells activated with Staphylococcus aureus Cowan I or pokeweed mitogen (PWM) to induce immunoglobulin M (IgM), IgG and IgA production, but not on resting B cells. Furthermore, IL-6 was shown to augment the primary and secondary anti-SRBC (sheep red blood cell) antibody production in mice in vivo.
Amino Acid Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Physical Appearance:
Lyophilized powder
Buffer:
20mM Tris, 100mM NaCl, pH8.0
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability and Storage
- 12 months from date of receipt, -20 to -70 °C as supplied.
- 6 months, -20 to -70 °C under sterile conditions after reconstitution.
- 1 week, 2 to 8 °C under sterile conditions after reconstitution.
Note: Please avoid repeated freeze-thaw cycles