Mouse Fibroblast Growth Factor-4 (mFGF4)
Type: | Recombinant | Cat. No.: | 42B070 |
Source: | E. coli | Size: | 0.1 mg |
Species: | Mouse | Purity: | >95% |
Description
Recombinant Mouse FGF4 without Signal peptide (AA 30-202), total 196 amino acids (AA). N-terminal 6xHis-tag and TEV cleavage site. Mw: 21.9 kDa (calculated). 23 extra AA left (In bold).
Introduction to the Molecule
FGF-4, also known as FGF-K or K-FGF (Kaposi’s sarcoma-associated FGF), is a heparin-binding member of the FGF family. It plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Mature mouse FGF-4 shares 87% aa identity with human FGF-4. FGF-4 is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.
Amino Acid Sequence
MSYYHHHHHHDYDIPTTENLYFQAPNGTRHAELGHGWDGLVARSLARLPVAAQPPQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL
Formulation
Lyophilized in 1 mg/mL in PBS.
Endotoxin Level
<0.2 EU/ug.
Applications
Cell culture, animal studies, ELISA and Western blotting.
Reconstitution
Add sterile deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.
Storage
Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. Avoid repeated freezing/thawing cycles